PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0292s0030.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 538aa    MW: 59715.4 Da    PI: 6.3434
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0292s0030.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like889e-28305359156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k +++Wt++LH++Fv+aveqL G ++A+P++ilelmkv+gLt+++v+SHLQkYR++
  Kalax.0292s0030.6.p 305 KMKVDWTSDLHKKFVQAVEQL-GVDQAIPSRILELMKVDGLTRHNVASHLQKYRMH 359
                          5689*****************.********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.69E-1116132IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.5E-1116140No hitNo description
PROSITE profilePS5011017.7519132IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-420126IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.90E-521131No hitNo description
Gene3DG3DSA:1.10.10.608.7E-27302361IPR009057Homeodomain-like
PROSITE profilePS5129414.484302361IPR017930Myb domain
SuperFamilySSF466896.99E-18303361IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-25305359IPR006447Myb domain, plants
PfamPF002492.0E-7308357IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MVCTADELLE WEDFPKGLRV LLLDRDVNYA SEIRSKLEGM DYIVSTFCDE DEALSAALSN  60
SEVFHVAIIE VSTVKCDGSF KFLQMAKGLP TVMTASAQCL TTTMKCIALG AIEVLNKPIC  120
EDKLRNIWQH VVHKAYSAVA ESPKQESTIR MVKDEEIRDK LRGGMPCLFD GGCNDEHDRS  180
PGDDKYPAPS TPQLKQVRLL DDAGCHDQTN WSSEKDSVAH YEESKSVETT SCNAAPDMSL  240
EAGEQMHESV VKEENNSADG CKSESDTSPG QKNEAETSSL GGNTRKQSKV SESRSPCGAK  300
TNRKKMKVDW TSDLHKKFVQ AVEQLGVDQA IPSRILELMK VDGLTRHNVA SHLQKYRMHR  360
RHALPKREER RISVRPKDTM QSSYYYQHKP VMAYPPPYHS NLTLLANQAC PVWATPGIHT  420
SGLHAWGPPY QTWPWKTCAV MQADAWGCPV MPPLHGSYSY YPQQNGYNGG VDISRNSMPP  480
NSHNDHHLAD EVVDQIVNEA ISKPWLPLPL GLKPPSTESV LSELSKQGIS SIPPPSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-17301358158ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279150.10.0PREDICTED: two-component response regulator-like APRR2
TrEMBLF6HTC70.0F6HTC7_VITVI; Putative uncharacterized protein
STRINGVIT_02s0012g00570.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-129ARR-B family protein